Product Added to your Cart
x

-------- OR --------

EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0,00 €
Folded Wedding Invitations
Watercolor Floral Rustic Wedding Invitation
Watercolor Floral Rustic Wedding Invitation
10,00 €
Blush Pink Luxury Wedding Invitation
Blush Pink Luxury Wedding Invitation
10,00 €
Black & Gold Wedding Invitation
Black & Gold Wedding Invitation
10,00 €
Blue Flower Bouquet Wedding Invitation
Blue Flower Bouquet Wedding Invitation
10,00 €
Custom Design Wedding Invitation
Custom Design Wedding Invitation
10,00 €
Gold Luxury Wedding Invitation
Gold Luxury Wedding Invitation
10,00 €
Green Sage Wedding Invitation
Green Sage Wedding Invitation
10,00 €
Ivory Black Minimalist Wedding Invitation
Ivory Black Minimalist Wedding Invitation
10,00 €
Navy & Gold Luxury Wedding Invitation
Navy & Gold Luxury Wedding Invitation
10,00 €
Navy & Gold Luxury Wedding Invitation
Navy & Gold Luxury Wedding Invitation
10,00 €
Navy Floral Wedding Invitation
Navy Floral Wedding Invitation
10,00 €
Peach Modern Wedding Invitation
Peach Modern Wedding Invitation
10,00 €
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i